Sign In | Join Free | My adobecards.com |
|
All ear plug for noise reduction wholesalers & ear plug for noise reduction manufacturers come from members. We doesn't provide ear plug for noise reduction products or service, please contact them directly and verify their companies info carefully.
Total 31 products from ear plug for noise reduction Manufactures & Suppliers |
|
![]() |
Brand Name:Futuretech Model Number:FTFE-03 Place of Origin:Shenzhen Safety Silicone Reusable Ear Plugs for personal hearing proctection Description of Reusable Ear plugs : Material The ear plugs are made of silicone, which is soft and comfortable to wear, the cord is made of nylon, which is strong and not easy to break dow... |
FUTURE TECH LIMITED
|
![]() |
Place of Origin:Zhejiang China Brand Name:FuXing Model Number:OEM ODM ... Sound Blocking Sleeping for Work, Travel, Concert, Shooting Range, Motorcycle, Sleep Snoring The ear plugs is capable to cancel up to 33 dB of noise and quiet the sound to a comfortable level. They come with alternative sizes. A proper size forms a |
JIAXING FUXING IMP. AND EXP. CO.,LTD
Zhejiang |
![]() |
Place of Origin:Changzhou, Jiangsu Brand Name:Good Job Description The Noise Ear Plugs realize the function to reduce work, home, sleep and safety noise. Due to the washable and reusable design, it is really friendly to the environment. As a matter of fact, it can be an ideal facility used for airplanes, ... |
CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Jiangsu |
![]() |
Brand Name:sweet Model Number:HT-034 Place of Origin:Ningbo ...Ear Plugs ears Protector Reusable Hearing Protection Noise Reduction Earplugs Earmuff Features: Reduce the noise can be reduced NRR: 24dB; SNR: 25dB Christmas tree profile design Soft string prevents winding, can be worn for a long time Detachable design, ear plugs... |
Sweet Home International(H.K.)Limited
Zhejiang |
![]() |
Brand Name:EARLISTEN Model Number:promo Place of Origin:CHINA Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise... |
Earlisten Electronic Co ., Ltd
Guangdong |
![]() |
Brand Name:EARLISTEN Model Number:promo Place of Origin:CHINA Noise Reduction Wired In Ear Earphones Yellow Color For Computer / Mobile Phone Product description Descreption. 1. 3.5mm Stereo plug 2. In ear type, Dual ear with MIC and refined MIC housing 3. high quality speaker, Hi-Fi sound quality 4. Stereo earphone with noise... |
Earlisten Electronic Co ., Ltd
Guangdong |
![]() |
Brand Name:UNIFORM Model Number:AUTC-HP-M1152 Place of Origin:CHINA ... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model Number AUTC-... |
Anhui Uniform Trading Co.Ltd
Anhui |
![]() |
Brand Name:HYQ Model Number:3404-FY148 Place of Origin:CHINA ...Ear Earphones Wired Earphone Information Item Number 3404-FY148 Communication Wired Earphone Color Multi color Plug 3.5mm straight plug Cable Flat cable Flat Cable Specification Impedance 24Ω±5Ω Speaker size 10MM Cable length 120CM Frequency range 20Hz-20KHz Sensitivity 100dB±5dB Max power input 10mW Feature High quality sound insulation Passive noise reduction... |
Guangzhou Huayi Electronic Factory
Guangdong |
![]() |
Brand Name:onikuma Model Number:k8 Place of Origin:China ...Ear Headphones with Volume Control LED Light Cool Style Stereo Noise Reduction Earphone features: Compatibility: With 3. 5mm audio cable jack (USB jack just work for LED light), wired stereo sound over ear gaming headset supports PC, Xbox One Controller(has 3. 5mm plug... |
Shenzhen Ouni Technology Co.,Ltd
|
![]() |
Brand Name:picun Model Number:ANC-02 Place of Origin:Made in China ... deep bass sound Noise reduction function can be enabled in a variety of states, including Bluetooth on or off, plug-in state Soft protein memory foam ear pads with large ear cups provide comfortable wearing Metal stretchable arm, rotatable and foldable, |
Golden Promise Industrial Mfg.Co.,Ltd.
|
![]() |
Place of Origin:china Brand Name:OEM Model Number:KBT-8252 ...3.5 plug audio cable to connect the headset to enjoy high quality music playback, good noise reduction function, functional. Bluetooth headset with pure piano paint appearance design, filling the atmosphere; full-size protein skin comfort ear, comfortable... |
ShenZhen Hua Xing Watches Co.,Ltd
Guangdong |