Sign In | Join Free | My adobecards.com
adobecards.com
Products
Search by Category
Home > Health & Medical > First Aid Kit >

Chemical Structure Of Insulin

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    chemical structure of insulin

    All chemical structure of insulin wholesalers & chemical structure of insulin manufacturers come from members. We doesn't provide chemical structure of insulin products or service, please contact them directly and verify their companies info carefully.

    Total 505 products from chemical structure of insulin Manufactures & Suppliers
     CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 Manufactures

    Brand Name:ChineseHormone

    Model Number:IGF-1 DES

    Place of Origin:China

    ...-1 Des1-3 is purified by proprietary chromatographic techniques. Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 Insulin-Like Growth Factor-1 DES (1-3): Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

     Raw Steroid Powder Pharmaceutical Chemical Dextromethorphan Hydrobromide / Romilar CAS 125-69-9 Manufactures

    Brand Name:YUANYANG

    Model Number:125-69-9

    Place of Origin:China

    ...Raw Steroid Powder Pharmaceutical Chemical Dextromethorphan Hydrobromide / Romilar CAS 125-69-9 Abstract Dextromethorphan Hydrobromide is the hydrobromide salt form of ...

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

     Chemical Use Glucosamine Pharmaceutical Raw Powder Material Chitosamine  3416-24-8 Manufactures

    Brand Name:HongKong Saichuang

    Model Number:Pharmaceutical

    Place of Origin:Hubei China

    ...Chemical use Glucosamine raw powder material Chitosamine for pharmaceutical no 3416-24-8 No.:3416-24-8 Purity:> ...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

     Long Arginine Growth Hormone Peptides 3- Igf -1 Igf -1 Lr3 Human Insulin Lr3 - Igf -1 Manufactures

    Brand Name:SENDI

    Model Number:YC001

    Place of Origin:CHINA

    ...Long Arginine Growth Hormone Peptides 3- Igf -1 Igf -1 Lr3 Human Insulin Lr3 - Igf -1 Product name IGF-1 LR3 Other name Long arginine 3-IGF-1;LR3-IGF-1 CAS 946870-...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

     99% Polypeptide Hormones Glucagon CAS 16941-32-5 For Anting Promoting Insulin & Islet Somatostatin within High Quality Manufactures

    Brand Name:pharm-china

    Model Number:16941-32-5

    Place of Origin:China

    ...High Purity Polypeptide Hormones Glucagon CAS 16941-32-5 Human Glucagon For Promoting Insulin & Islet Somatostatin Basic View: · Glucagon(1-29)(Human) · Sequence:H-His-Ser-Gln-Gly-Thr-Phe-Thr-...

    Shanghai Yijing Pharmaceutical Co.,Ltd
    Verified Supplier

    Shanghai

     Hexarelin Chemical Human Growth Hormone Peptide 2mg/vial CAS 140703-51-1 Manufactures

    Brand Name:Pharmlab

    Model Number:140703-51-1

    Place of Origin:China

    ...Hexarelin Chemical Human Growth Hormone Peptide 2mg/vial CAS 140703-51-1 Hexarelin Peptide Basic Info. Product Name ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

     White Lyophilized Powder Human Peptides Insulin-like growth factor - 1 Lyophilized Powder IGF DES Manufactures

    Brand Name:HongKong Blue

    Model Number:igf

    Place of Origin:CHINA

    ...Human Peptides Insulin-like growth factor - 1 Lyophilized Powder IGF DES >>>>>>>>>Our service Good quality: We insist that quality ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

     Polypeptide Hormones Glucagon CAS 16941-32-5 For Promoting Insulin & Islet Somatostatin Manufactures

    Place of Origin:China(Mainland)

    Brand Name:SUPER STEROIDS

    Model Number:16941-32-5

    ...99% Polypeptide Hormones Glucagon CAS 16941-32-5 Human Glucagon For Promoting Insulin & Islet Somatostatin Quick Details: Glucagon(1-29)(Human) Sequence:H-His-Ser-Gln-Gly-Thr-Phe-Thr-...

    Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
    Verified Supplier

    Hubei

     Polypeptide Hormones Human Growth Peptides Glucagon Powder for Promoting Insulin 16941-32-5 Manufactures

    Brand Name:Guangzhou Huao

    Model Number:16941-32-5

    Place of Origin:Guangzhou China

    ...-Leu-Met-Asn-Thr-OH Glucagon Description: Glucagon can be known as glucagon or anti insulin or insulin B. It can be accompanied by a hormone

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

     98% Chemical Raw Steroids , Growth Hormone Peptides 140703-51-1 Hexarelin To Lose Weight Manufactures

    Brand Name:Kafen

    Model Number:140703-51-1

    Place of Origin:Guangdong

    ...98% Chemical Raw Steroids , Growth Hormone Peptides 140703-51-1 Hexarelin To Lose Weight 1 . Quick Details: Product Name: ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

     Active Pharmaceutical Ingredients Pizotifen For Antimigraine CAS 15574-96-6 Manufactures

    Brand Name:JNJG

    Model Number:15574-96-6

    Place of Origin:CHINA

    Active Pharmaceutical Ingredients Pizotifen For Antimigraine CAS 15574-96-6 Quick Detail Product Name Pizotifen Synonym Pizotylene;PIZOTHIFENUM;Pizotifenum;Pizotyline (base and/or unspecified salts);4-OXO-9,10-DIHYDRO-4H-BENZO(4,5) CYCLOHEPTO(1,2,B) ...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

     Injectable Steroid Anadrol 50 / Oxymetholone Mg/Ml Liquid for Cutting Cycle 434-07-1 Manufactures

    Brand Name:Anadrol 50

    Model Number:Anadrol 50

    Place of Origin:China

    Injectable Steroid Anadrol 50 / / Oxymetholone Mg/Ml Liquid for Cutting Cycle 434-07-1 Anadrol Description Anadrol is an orally active anabolic steroid, which means it has been C17 Alpha Alkylated in order to allow the anabolic steroid to make the first ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

     CAS 10161-33-8 Tren Anabolic Steroid Trenbolone Base Trenbolone Powder Manufactures

    Brand Name:Zhenxiang

    Model Number:10161-33-8

    Place of Origin:CHINA

    ... C18H22O2 MW 270.37 EINECS N/A mp 170°C storage temp. 2-8°C Product Categories Steroids;Intermediates & Fine Chemicals;Pharmaceuticals;Steroid and Hormone;Finished Steroid and Hormone;trenbolone series Trenbolone Trenbolone is one of...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

     Health Muscle Growth Steroids Anadrol 50 / Oxymetholone Mg/Ml Liquid for Cutting Cycle 434-07-1 Manufactures

    Brand Name:HKYC

    Model Number:Anadrol 50

    Place of Origin:China (mainland)

    Health Muscle Growth Steroids Anadrol 50 / Oxymetholone Mg/Ml Liquid for Cutting Cycle 434-07-1 Hello,I'm Lily,please feel free to contact me. Email:mxy012@ycphar.com Whatsapp:+8618029242094 Skype:live:mxy012 Anadrol 50 Quick Details: Product Name: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

     CJC1295 With DAC powerful Peptides Bodybuilding growth muscle white powder Manufactures

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:china

    CJC1295 With DAC powerful Peptides Bodybuilding growth muscle white powder Basic Info CJC1295dac 2mg Per Vial From China CJC 1295 with DAC other name: CJC1295dac, CJC1295withDAC CAS No.:863288-34-0 Standard: Medicine Grade Classification: Brassinosteroid ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

     Cosmetic White Powder BETA-NMN Beta - Nicotinamide Mononucleotide for Anti Aging Manufactures

    Brand Name:WM

    Model Number:1094-61-7

    Place of Origin:China

    Cosmetic White Powder BETA-NMN Beta - Nicotinamide Mononucleotide for Anti Aging 1) Beta-Nicotinamide Mononucleotide Info: Product Name Beta-Nicotinamide Mononucleotide Synonyms BETA-NMN;Beta-Nicotinamide Mononucleotide;Beta-Nicotinamide Ribose ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

     99% Purity Progesterone CAS 57-83-0 Legal Steroids Manufactures

    Brand Name:hksteroids

    Model Number:57-83-0

    Place of Origin:HK

    Progesterone (abbreviated as P4), also known as pregn-4-ene-3,20-dione,[5][6] is an endogenous steroid and progestogen sex hormone involved in the menstrual cycle, pregnancy, and embryogenesis of humans and other species.[7] It belongs to a group of ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

     CJC -1295 Without DAC Peptide Hormones Muscle Building CAS 863288-34-0 Manufactures

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:whatsapp: +86 138 7101 4054

    High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH). Their action in the human body is ...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

     74.5kD Insulin Like Growth Factor IGF 1 Human Recombinant Protein Plant Derived Manufactures

    Brand Name:Oryzogen

    Model Number:HY202M1

    Place of Origin:China

    ...74.5kD Insulin Like Growth Factor IGF 1 Human Recombinant Protein Plant Derived Description As a kind of hormone, IGF-1 ...

    Wuhan Healthgen Biotechnology Corp.
    Active Member

    Hubei

     Injectable HGH Hormones Igtropin Insulin-like Growth Factors Mass Building Supplements Manufactures

    Brand Name:Igtropin

    Model Number:100mcg/vial, 10vials/kit

    Place of Origin:China

    ... Growth Factors Mass Building Supplements Description: Long-R3 IGF-1, is also called insulin-like growth factor, mediates the human growth hormone (HGH). Notable effects of the drug include - ...

    Guangzhou GenRay Biological Technology Co., Ltd
    Active Member

    Guangdong

    Inquiry Cart 0